PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0574s0270.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 285aa    MW: 30686 Da    PI: 8.327
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0574s0270.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702180.28.8e-56812386154
                  DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                              +C+dCGn+akk+C+++RCRtCCksr++dC+th+kstWv+a+ rrer        s+a++       kr+re+ +++++ + st+ +
  SapurV1A.0574s0270.1.p  81 RACRDCGNRAKKECQYRRCRTCCKSREYDCTTHMKSTWVSASSRRERLGCSGGGDSSASSGGGCVGGKRPRENATTTSN-SFSTSNN 166
                             58**********************************************9999999999888888999999987333333.3333334 PP

                  DUF702  93 saeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                             +a ++ +++t s          lP +v+ +avfrcvrv++++ ge+e+aYq+ v+i+GhvfkG+LydqG++e
  SapurV1A.0574s0270.1.p 167 NAAASVNFDTGSsyqdagfklsLPVQVREPAVFRCVRVTAINSGEAEVAYQAKVNISGHVFKGVLYDQGIDE 238
                             4444445555557888999999***********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.4E-5381237IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.6E-2383124IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.4E-24189236IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLGLHNILFI APPPSPFHHH QTPQVPSAHH IANTNDQCNI ADNQESWATL NKYQQKPCFL  60
KTGDLNVAGE DDTGRNIGPA RACRDCGNRA KKECQYRRCR TCCKSREYDC TTHMKSTWVS  120
ASSRRERLGC SGGGDSSASS GGGCVGGKRP RENATTTSNS FSTSNNNAAA SVNFDTGSSY  180
QDAGFKLSLP VQVREPAVFR CVRVTAINSG EAEVAYQAKV NISGHVFKGV LYDQGIDEKN  240
LFPCISKLQS GERTRDSTSS IVEPSAAYAA TGNHRLLEGT NCTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368621.11e-168hypothetical protein POPTR_0001s06500g
SwissprotQ94CK99e-48LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLU5GNS81e-168U5GNS8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s06500.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57043154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.23e-46Lateral root primordium (LRP) protein-related